Objective: IDA1
Binding specificity: AA 582-613, C term
Reactivity: Human, Mouse, Rat
Host: Mouse
Clonality: Monoclonal
Conjugate
This AIF1 antibody is not conjugated
Request
Flow cytometry (FACS), immunofluorescence (IF), immunohistochemistry (paraffin-embedded sections) (IHC (p)), Western blot (WB)
Purpose
Mouse IgG monoclonal antibody for detection of AIF. Tested with WB, IHC-P, IF, FCM in humans, mice, and rats.
Cross-reactivity
No cross-reactivity with other proteins.
Characteristics
Mouse IgG monoclonal antibody for detection of AIF. Tested with WB, IHC-P, IF, FCM in humans, mice, and rats.
Purification
Immunogenic affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AIF (582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
Clone: 2I5
Isotype: IgG
Application notes
Application details: Western blot | 0.1-0.5 µg / mL Immunohistochemistry (Paraffin embedded section) | 0.5-1 & mu, g / mL Immunofluorescence | 2 µ, g / mL Flow cytometry | 1-3 µg / 1×106 cells
Commentary
Tested Species: Species tested internally with positive results. By heat: It is required to boil the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 minutes for the staining of the formalin/paraffin sections. Other applications have not been tested. End-users must determine the optimal dilutions.
Format: Lyophilized
Reconstitution
Adding 0.2 ml of distilled water will produce a concentration of 500 μg / ml.
Buffer
Each vial contains 4 mg of trehalose, 0.9 mg of NaCl, 0.2 mg of Na2HPO4, 0.05 mg of sodium azide.
Preservative: Sodium azide
Usage precaution
This product contains sodium azide: a HAZARDOUS AND POISONOUS SUBSTANCE that should only be handled by trained personnel.
Storage: 4 ° C, -20 ° C
Storage comment
- At -20 ° C for one year. After reconstitution, at 4 ° C for one month.
- It can also be aliquoted and stored frozen at -20 ° C for longer. Avoid repeated freezing and thawing.
Background:
Mitochondrial apoptosis-inducing factor 1, also known as AIF or PDCD8, is a protein that is encoded in humans by the AIFM1 gene. The AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells and is found in the mitochondrial intermembrane space in healthy cells.
The induction of apoptosis results in the translocation of this protein to the nucleus where it affects the condensation and fragmentation of the chromosomes. Furthermore, this gene product induces mitochondria to release the apoptotic proteins cytochrome c and caspase-9. Mutations in this gene cause a combined deficiency of oxidative phosphorylation 6, leading to severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.
